SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020593 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020593
Domain Number 1 Region: 480-824
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 4.05e-116
Family Rap/Ran-GAP 0.000000541
Further Details:      
 
Domain Number 2 Region: 953-1027
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000133
Family PDZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020593
Domain Number - Region: 1728-1776
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0837
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020593   Gene: ENSGGOG00000013648   Transcript: ENSGGOT00000027040
Sequence length 1797
Comment pep:known_by_projection chromosome:gorGor3.1:14:52778067:52989831:1 gene:ENSGGOG00000013648 transcript:ENSGGOT00000027040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLKRSQTERPLATDRASVVGTDSTPKVHTDDFYMRRFRSQNGSLGSSVMAPVGPPRSE
GSHHITSTPGVPKMGVRARIADWPPRKENIKESSRSSQEIETSSCLDSLSSKSSPVSQGS
SVSLNSNDSAMLKSIQNTLKNKTRPSENMDSRFLMPEAYPSSPRKALRRIRQRSNSDITI
SELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTP
TKLSDFLITGGGKGSGFSLDVIDGPISQRENLRLFKEREKPLKRRSKSETGDSSIFRKLR
NAKGEELGKSSDLEDNRSEDSVRPWTCPKCFAHYDVQSILFDLNEAIMNRHNVIKRRNTT
TGASAAAVASLVSGPLSHSASFSSPMGSTEDLNSKGSLSMDQGDDKSNELVMSCPYFRNE
IGGEGERKISLSKSNSGSFSGCESASFESTLSSHCTNAGVAVLEVPKENLVLHLDRVKRY
IVEHVDLGAYYYRKFFYQKEHWNYFGADENLGPVAVSIRREKPDEMKENGSPYNYRIIFR
TSELMTLRGSVLEDAIPSTAKHSTARGLPLKEVLEHVVPELNVQCLRLAFNTPKVTEQLM
KLDEQGLNYQQKVGIMYCKAGQSTEEEMYNNESAGPAFEEFLQLLGERVRLKGFEKYRAQ
LDTKTDSTGTHSLYTTYKDYEIMFHVSTMLPYTPNNKQQLLRKRHIGNDIVTIVFQEPGA
QPFSPKNIRSHFQHVFVIVRVHNPCSDSVCYSVAVTRSRDVPSFGPPIPKGVTFPKSNVF
RDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAEKNVTNTPIDPSGKFPFISLASK
KKEKSKPYPGAELSSMGAIVWAVRAEDYNKAMELDCLLGISNEFIVLIEQETKSVVFNCS
CRDVIGWTSTDTSLKIFYERGECVSVGSFINNEEIKEIVKRLQFVSKGCESVEMTLRRNG
LGQLGFHVNYEGIVADVEPYGYAWQAGLRQGSRLVEICKVAVATLSHEQMIDLLRTSVTV
KVVIIPPHDDCTPRRSCSETYRMPVMEYKMNEGVSYEFKFPFRNNNKWQRNASKGPHSPQ
VPSQVQSPMTSRLNAGKGDGKMPPPERAANIPRSISSDGRPLERRTCRLSPGSDIYVTVS
SMALARSQCRNSPSNLSSSSDTGSVGGTYRQKSMPEGFGVSRRSPASIDRQNTQSDIGGS
GKSTPSWQRSEDSIADQMAYSYRGPQDFNSFVLEQHEYTEPTCHLPAVSKVLPAFRESPS
GRLMRQDPVVHLSPNKQGHSDSHYSSHSSSNTLSSNASSAHSDEKWYDGDRTESELNSYN
YLQGTSADSGIDTTSYGPSHGSTASLGAATSSPRSGPGKEKVAPLWHSSSEVISMADRTL
ETESHGLDRKTESSLSLDIHSKSQAGSSPLTRENSTFSINDAASHTSTMSSRHSASPVVF
TSARSSPKEELHPAAPSQLAPGPRSFYPRQGATSKYLIGWKKPEGTINSVGFMDTRKRHQ
SDGNEIAHTRLRASTRDLRASPKPTSKSTIEEDLKKLIDLESPTPESQKSFKFHALSSPQ
SPFPSTPTSRRALHRTLSDESIYSSQREHFFTSRASLLDQALPNDVLFSSTYPSLPKSLP
LRRPSYTLGMKSLHGEFSASDSSLTDIQETRRQPMPDPGLMPLPDTAADLDWSNLVDAAK
AYEVQRASFFAASDENHRPLSAASNSDQLEDQALAQMKPYSSSKDSSPTLASKVDQLEGM
LKMLREDLKKEKEDKAHLQAEVQHLREDNLRLQEESQNASDKLKKFTEWVFNTIDMS
Download sequence
Identical sequences ENSGGOP00000020593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]