SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020599 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020599
Domain Number 1 Region: 56-134
Classification Level Classification E-value
Superfamily HMG-box 1.7e-18
Family HMG-box 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020599   Gene: ENSGGOG00000024929   Transcript: ENSGGOT00000026681
Sequence length 395
Comment pep:novel chromosome:gorGor3.1:6:84434315:84435535:-1 gene:ENSGGOG00000024929 transcript:ENSGGOT00000026681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKRPSYAPSPTPASATQMPSTPAFAGYNPYCHLAYSNYRLGGNPATNSRVRGSSSITIP
KPPKPPDKPLMPYMRYSRKVWDQVKASNPDVKLWEIGKIIAGMWQNLADEEKQYLNEYEV
EKIEYNESMNAHHNSPVYLAYINAKSLAEAALEEDSQLKQSHMEKGEPYMSLLDYDDGFS
MKTATVRFQRNRRLISEILSESVVPEVQSVVTTTRMQVPKQQVQSLMVHQRKLEAELLPK
EDRHQEKAKFLESTDSFNNELKRLCGLKIEMDLEKTAAEMAQAEEQSHKRQEEREKEAAD
ESSIVPEEEPVANKGEGKKDNENIPIKTEETRLEETTEQQNGEGGKSTEDKESGQERVDS
MAEEGTSDSNTGSERNGATVEGPPRDPILEDEKKE
Download sequence
Identical sequences ENSGGOP00000020599 ENSGGOP00000020599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]