SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020653 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000020653
Domain Number - Region: 318-327
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020653   Gene: ENSGGOG00000014210   Transcript: ENSGGOT00000022307
Sequence length 481
Comment pep:novel chromosome:gorGor3.1:1:13838:39718:-1 gene:ENSGGOG00000014210 transcript:ENSGGOT00000022307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVMCLKASDTWASGTRSRPQGCLGKWRSVRRKHTRMHLAHLGNSRQLISLGPPRTRED
GSRISQRVEQSRSQVQAIGEKVSLAQAKIEKIKGSKKAIKVFSSAKYPAPERLQEYGSIF
TGAQDPGLQRRPRHRIQSKHRPLDERALQEKLKYFPVCVSTKPEPEDDAEEGLGGLPSNI
SSVSSLLLFNTTENLYKKYVFLDPLAGAVTKTHVMLGAETEEKLFDAPLSISKREQLEQQ
VPENYFYVPDLGQVPEIDVPSYLPDLPGIANDLMYSVDLGPGIAPSAPGTIPELPTFHTE
VAEPLKADLQDGVLTAPPPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSIA
SPSVQGAPREVVDPSGGRATLLESIRQAGGIGKAKLRSVKERKLEKKKQKEQEQVRATSQ
GGDLMSDLFNKLVMRRKGISGKGPGAGEGPGGAFARVSDSIPPLPPPQQPQAEEDEDDWE
S
Download sequence
Identical sequences ENSGGOP00000020653 ENSGGOP00000027140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]