SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020715 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020715
Domain Number 1 Region: 2231-2384
Classification Level Classification E-value
Superfamily CalX-like 1.11e-30
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 2 Region: 3926-4070
Classification Level Classification E-value
Superfamily CalX-like 1.31e-30
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1726-1812,1840-1900
Classification Level Classification E-value
Superfamily CalX-like 6.41e-30
Family CalX-beta domain 0.00054
Further Details:      
 
Domain Number 4 Region: 2960-3088
Classification Level Classification E-value
Superfamily CalX-like 2.75e-29
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 5 Region: 2598-2715
Classification Level Classification E-value
Superfamily CalX-like 6.02e-28
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 6 Region: 1004-1133
Classification Level Classification E-value
Superfamily CalX-like 5.89e-27
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 7 Region: 2117-2247
Classification Level Classification E-value
Superfamily CalX-like 7.06e-27
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 8 Region: 3584-3688
Classification Level Classification E-value
Superfamily CalX-like 4.71e-26
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 9 Region: 4410-4531
Classification Level Classification E-value
Superfamily CalX-like 4.05e-25
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 10 Region: 153-291
Classification Level Classification E-value
Superfamily CalX-like 1.15e-24
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 11 Region: 4265-4397
Classification Level Classification E-value
Superfamily CalX-like 2.35e-24
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 12 Region: 1130-1281
Classification Level Classification E-value
Superfamily CalX-like 1.31e-22
Family CalX-beta domain 0.0035
Further Details:      
 
Domain Number 13 Region: 4661-4799
Classification Level Classification E-value
Superfamily CalX-like 1.44e-22
Family CalX-beta domain 0.0072
Further Details:      
 
Domain Number 14 Region: 414-551
Classification Level Classification E-value
Superfamily CalX-like 1.57e-22
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 15 Region: 786-927
Classification Level Classification E-value
Superfamily CalX-like 1.7e-21
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 16 Region: 5003-5131
Classification Level Classification E-value
Superfamily CalX-like 2.75e-21
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 17 Region: 1312-1484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.94e-21
Family Pentraxin (pentaxin) 0.075
Further Details:      
 
Domain Number 18 Region: 886-1003
Classification Level Classification E-value
Superfamily CalX-like 2.49e-20
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 19 Region: 5220-5376
Classification Level Classification E-value
Superfamily CalX-like 3.79e-20
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 20 Region: 1880-1986
Classification Level Classification E-value
Superfamily CalX-like 5.1e-20
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 21 Region: 1988-2130
Classification Level Classification E-value
Superfamily CalX-like 8.11e-20
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 22 Region: 4051-4188
Classification Level Classification E-value
Superfamily CalX-like 9.16e-20
Family CalX-beta domain 0.0033
Further Details:      
 
Domain Number 23 Region: 1585-1712
Classification Level Classification E-value
Superfamily CalX-like 2.88e-19
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 24 Region: 660-804
Classification Level Classification E-value
Superfamily CalX-like 7.72e-19
Family CalX-beta domain 0.0089
Further Details:      
 
Domain Number 25 Region: 2348-2393,2495-2573
Classification Level Classification E-value
Superfamily CalX-like 1.44e-18
Family CalX-beta domain 0.0031
Further Details:      
 
Domain Number 26 Region: 3668-3812
Classification Level Classification E-value
Superfamily CalX-like 1.96e-18
Family CalX-beta domain 0.007
Further Details:      
 
Domain Number 27 Region: 3096-3205
Classification Level Classification E-value
Superfamily CalX-like 1.96e-17
Family CalX-beta domain 0.0055
Further Details:      
 
Domain Number 28 Region: 2828-2968
Classification Level Classification E-value
Superfamily CalX-like 4.05e-17
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 29 Region: 2703-2838
Classification Level Classification E-value
Superfamily CalX-like 1.1e-16
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 30 Region: 264-399
Classification Level Classification E-value
Superfamily CalX-like 1.83e-16
Family CalX-beta domain 0.0055
Further Details:      
 
Domain Number 31 Region: 38-156
Classification Level Classification E-value
Superfamily CalX-like 4.58e-16
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 32 Region: 1499-1581
Classification Level Classification E-value
Superfamily CalX-like 5.1e-16
Family CalX-beta domain 0.0067
Further Details:      
 
Domain Number 33 Region: 5499-5653
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000863
Family CalX-beta domain 0.0041
Further Details:      
 
Domain Number 34 Region: 4170-4276
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000017
Family CalX-beta domain 0.0068
Further Details:      
 
Domain Number 35 Region: 3774-3909
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000288
Family CalX-beta domain 0.0029
Further Details:      
 
Domain Number 36 Region: 4537-4650
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000837
Family CalX-beta domain 0.0046
Further Details:      
 
Domain Number 37 Region: 5368-5507
Classification Level Classification E-value
Superfamily CalX-like 0.000000000301
Family CalX-beta domain 0.017
Further Details:      
 
Domain Number 38 Region: 4762-4870
Classification Level Classification E-value
Superfamily CalX-like 0.000000196
Family CalX-beta domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020715
Domain Number - Region: 3210-3248
Classification Level Classification E-value
Superfamily CalX-like 0.0238
Family CalX-beta domain 0.014
Further Details:      
 
Domain Number - Region: 4898-4984
Classification Level Classification E-value
Superfamily CalX-like 0.0994
Family CalX-beta domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020715   Gene: ENSGGOG00000010968   Transcript: ENSGGOT00000029486
Sequence length 5954
Comment pep:known_by_projection chromosome:gorGor3.1:5:73453699:74008625:1 gene:ENSGGOG00000010968 transcript:ENSGGOT00000029486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSILAILGMPSASLLVNLLSALLILFVFGETEIRFTGQTEFVVNETSTTVIRLIIERIGE
PANVTAIVSLYGEDTGDFFDTYAAAFIPAGETNRTVYIAVCDDDLPEPDETFIFHLTLQK
PSANVKLGWPRTVTVTILSNDNAFGIISFNMLPSITVSEPKGRNESIPLTLIREKGTYGM
VMVTFEVEGGPNPPDEDLSPVKGNITFPPGRATVIYNLTVLDDEVPENDEIFLIQLKSVE
GGAEINTSRNSIEIIIKKNDSPVRFLQSIYLVPEEDHILIIPVVRGKDNNGNLIGSDEYE
VSISYAVTTGNSTAHAQQNLDFIDLQPNTTVVFPPFIHESHLKFQIVDDTIPEIAESFHI
MLLKDTLQGDAVLISPSVVQVTIKPNDKPYGVLSFNSVLFERTVIIDEDRISRYEEITVV
RNGGTHGNVSANWVLTRNSTDPSPVTADIRPSSGVLHFAQGQMLATIPLTVVDDDLPEEA
EAYLLQILPHTIRGGAEVSEPAELLFYIQDSDDVYGLITFFPMENQKIESSPGERYLSLS
FTRLGGTKGDVRLLYSVLYIPAGAVDPLQAKEGILNISRRNDLIFPEQKTQVKTKQFVKN
PISRINSITFLISLETVELLNIIPPIPPISPRFGEICNISLLVTPAIANGEIGFLSNLPI
ILHEPEDFAAEVVYIPLHRDGTDGQATVYWSLKPSGFNSKAVTPDDIGPFNGSVLFLSGQ
SNTTINITIKGDDIPEMNETVTLSLDRVNVENQVLKSGYTSRDLIILENDDPGGVFEFSP
ASRGPYVIKEGESVELHIIRSRGSLVKQFLHYRVEPRDSNEFYGNTGVLEFKPGEREIVI
TLLARLDGIPELDEHYWVVLSSHGERESKLGSATIVNVTILKNDDPHGIIEFVSDGLIVM
INESKGDAIYSAVYDVVRNRGNFGDVSVSWVVSPDFTQDVFPVQGTVVFGDQEFSKNITI
YSLPDEIPEEMEEFTVILLNATGGAKVGNRTTATLRIRRNDDPIYFAEPRVVRVQEGETA
NFTVLRNGSVDVTCMVQYATKDGKATARERDFIPVEKGETLIFEVGSRQQNISIFVNEDG
IPETDEPFYIILFNSTGDTVVYQYGVATVIIEANDDPNGIFSLEPIDKAVEEGKTNAFWI
LRHRGYFGSVSVSWQLFQNDSALQPGQEFYETSGTVNFMDGEEAKPIILHAFSDKIPEFN
EFYFLKLVNISGGSPGPGGQLAETNLQVTVMIPFNDDPFGVFILDPECLEREVAEDVLSE
DDMSYITNFTILRQQGVLGDVRLGWEILSSEFPAGLPPMIDFLLVGIFPTTVHLQQHMRR
HHSGTDALYFTGLEGAFGTVNPKYHPSRNNTIANFTFSAWVMPNANTNGFIIAKDDGNGS
IYYGVKIQTNESHVTLSLHYKTLGSNATYIAKTTVMKYLEESVWLHLLIILEDGIIEFYL
DGNAMPRGIKSLKGEAITDGPGILRIGAGINGNDRFTGLMQDVRSYEQKLTLEEIYELHA
MPAKSDLHPISGYLEFRQGETNKSFIISARDDNDEEGEELFILKLVSVYGGARILEENTT
ARLTIQKSDNANGLFGFTGACIPEIAEEGSTISCVVERTRGVLDYVHVFYTISQIETDGI
NYLIDDFANASGTITFLPWQRSEVLNIYVLDDDIPELNEYFRVTLVSAIPGDGKLGSTPT
SGASIDPEKETTDITIKASDHPYGLLQFSTGLPPQPEDAMTLPASSVPHITVEEEDGEIR
LLVIRAQGLLGRVTAEFRTVSLTAFSPEDYQNVAGTLEFQPGERYKYISINITDNSIPEL
EKSFKVELLNLEGGVAEFFRVDGSGSGDGDMEFFLPTIHKHASLGVASQILVTIAASDHA
HGVFEFSPESLFVSGTEPEDGYSTVTLNVIRHHGTLSPVTLHWNIDSDPDGDLAFTSGNI
TFEIGQMSANITVEILPDEDPELDKAFSLSILSVSSGSLGAHINATLTVLASDDPYGVFI
FSEKNRPVKVEEATQNITLSIIRLKGLMGKVLVSYATLDDMEKPPYFPPNLARATQGRDY
IPASGFALFGANQSEATIAISILDDDEPERSESVFIELLNSTLIAKVQSRSIPNSPRLGP
KVETVAQLIIIANDDAFGTLQLSAPIVRVAENHVGPIINVTRTGGAFADVSVKFKAVPIN
AIAGEDYSIASSDVVLLEGETSKAVPIYIINDIYPELEESFLVQLMDETTGGARLGALTE
AVIIIEASDDPYGLFGFQITKLIVEEPEFNSVKVNLPIIRNSGTLGNVTVQWVATINGQL
ATGDLRVVSGNVTFAPGETIQTLLLEVLADDVPEIEEVIQVQLTDASGGGTIGLDRIANI
IIPANDNPYGTVAFAQTVYRVQEPLERSSCANITVRRSGGHFGRLLLFYSTSNIDVVALA
MEEGQDLLSYYESPIQGVPDPLWRTWMNVSAVGEPLYTCATLCLKEQACSAFSFFSASEG
PQCFWMTSWISPAVNNSDFWTYRKNMTRVASLFSGQAVAGSDYEPVTRQWAVMQEGDEFA
NLTVSILPDDFPEMDESFLISLLEVHLMNISASLKNQPTIGQPNISTVVIALNGDAFGVF
VIYSISPNTSEDGLFVEVQEQPQTLVELTIHRTGGSLGQVAVEWRVVGGTATEGLDFIGA
GEILTFAEGETKKTVILTILDDSEPEDDESIIVSLVYTEGGSRILPSSDTVRVNILANDN
VAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFF
PEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAAVLTVEASD
EPHGVLNFALSSRFVLLQEANITIQLFINREFGSLGAINVTYTTVPGMLSLKNQTVGNLA
EPEVDFVPVIGFLILEEGETAAAINITILEDDIPELEEYFLVNLTYVELTMAASTSFPPR
LDSEGLTAQIIIDANDGARGVIEWQQSRFEVNETHGSLTLVAQRSREPLGHVSLFVYTQN
LEAQVGLDYIFTPMILHFADGERYKNVNIMILDDDIPEGDEKFQLILTNPSPGLELGKNT
IALIIVLANDDGPGVLSFNNSEHFFLREPTALYVQESVAVLYIVREPAQGLFGTVTVQFI
VTEVNSSNESKDLTPSKGYIVLEEGVRFKALQISAILDTEPEMDEYFVCTLFNPTGGARL
GAHVQTLITVLQNQAPLGLFSISAVENRATSIDIEEANRTVYLNVSRTNGIDLAVSVQWE
TVSETAFGMRGMDVVFSVFQSFLDESASGWCFFALENLIYGIMLRKSSVTVYRWQGIFIP
VQDLNIENPKTCEAFNIGFSPYFVITHEERNEEKPSLNSVFTFTSGFKLFLVQTIIILES
SQVRYFTSDSQDYLIIASQRDDSELTQVFRWNGGSFVLHQKLPVRGVLTVALFNKGGSVF
LAISQANARLNSLLFRWSGSGFINFQEVPVSGTTEVEALSSANDIYLIFAKNVFLGDQNS
IDIFIWEMGQSSFRYFQSLDFAAVNRIHSFTPASGIAHILLIGQDMSALYCWNSERNQFS
FVLEVPSAYDVASVTVKSLNSSKNLIALVGAHSHIYELAYISSHSDFIPSSGELIFEPDD
REATIAVNILDDTVPEKEESFKVQLKNPKGGAEIGINDSVTITILSNDDAYGIVAFAQNS
LYKQVEEMEQDSLVTLNVERLKGTYGRITIAWEADGSISDIFPTSGVISFTEGQVLSTIT
LTILADNIPELSEVVIVTLTRITTEGVEDSYKGATIDQDRSKSVITTLPNDSPFGLVGWH
AASVFIRVTEPKENTTTLQLQIARDKGLLGDIAIHLRAQPNFLLHVDNQATENEDYVLQE
TIIIMKENIKEAHAKVSILPDDLPELEEGFIVTITEVNLVNSDFSTGQPSVRSPGMEIAE
IMIEENDDPRGIFIFHVTRGAGEVITAYEVPPPLNVLQVPVVRLAGSFGAVNVYWKASPD
SAGLEDFKPSHGILEFADKQVTAMIEIAIIDDAEFELTETFNISLISVAGGGRLGDDVVV
TVVIPQNDSPFGVFGFEEKTVMIDESLSSDDPDSYVTLTVVRSPGGKGTVRLEWTIDEKA
KHNLSPLNGTLHFDETESRKTIVLHTLQDTVLEEDRRFTIQLISVDEVEISPVKGSASII
IRGDKRASGEVGIAPSSRHILIGEPSAKYNGTAIISLVRGPGILGEVTVFWRIFPPSVGE
FAETSGKLTMRDEQSAVIVVIQALNDDIPEEKSFYEFQLTAVSEGGVLSESSSTANITMV
ASDSPYGLFAFSHEQLRVSEAQRVNITIIRSGGDFGCVRLWYETMSGTAEAGLDFVPAAG
ELLFEAGEKRKSLHVEILDDDYPEGPEEFSLTVTKVELQDFGRGYDFTIQENGLQIDQPP
EIGNISIVRIIIMKNDNSEGIIEFDPKYTAFEVEEDVGLIMIPVVRLRGTYGYVTADFIS
QSSSASPGGVDYILHGSTVTFQHGQNLSFINISIIDDNESEFEEPIEILLTGATGGAVLG
RHLVSRIIIAKSDSPFGVIRFLNQSKISIPNPNSTMILSLVLERTGGLLGEIQVNWETVG
PNSQEALLPQNRDIADPVSGLFYFGEGEGGVRTIILTIYPHEEIEVEETFIIKLHLVKGE
AKLDSRAKDVTLTIQKFGDPNGVVQFAPETLSKKTYSEPLALEGPLLITFFVRRVKGTFG
EIMVYWELSSEFDITEDFLSTSGFFTIADGESEASFDVHLLPDEVPEIEEDYVIQLVSVE
GGAELDLEKSITWFSVYANDDPHGVFALYSDRQSILIGQNLIRSIQINITRLAGTFGDVA
VGLRISSDHKEQPIVTENAERQLVVKDGATYKVDVVPIKNQVFLSLGSNFTLQLVTVMLV
GGRFYGMPTILQEAKSAVLPVSEKAANSQVGFESTAFQLMNITAGTSHVMISRRGTYGAL
SVAWTTGYAPGLEIPELIVVGNMTPTLGSLSFSHGEQRKGVFLWTFPSPGQPEAFVLHLS
GVQSSAPGGAQLRSGFIVAEIEPVGIFQFSTSSRNIIVSEDTQMIRLHVQRLFGFHSDLI
KVSYQTTAGSAKPLEDFEPVQNGELFFQKFQTEVDFEITIINDQLSEIEEFFYINLTSVE
IRGLQKFDVNWSPRLNLDFSVAVITILDNDDLAGMDISFPKTTVAVAVDTTLIPVETEST
TYLSTSKTTTILQPTNVVAIVTEATGVSAIPEKLVTLHGTPAVSEKPDVATVTANVSIHG
TFSLGPSIVYVEEEMKNGTFNTAEVLIRRTGGFTGNVSITVKTFGERCAQMEPNALPFRG
IYGISNLTWAVEEEDFEEQTLTLIFLDGERERKVSVQILDDDEPEGQEFFYVFLTNPQGG
AQIVEGKDGTGFAAFAMVIITGSDLHNGIIGFSEESQSGLELREGADMRRLHLIVTRQPN
RAFEDVKVFWRVTLNKTVVVLQKDGVNLMEELQSVSGTTTCTMGQTKCFISIELKPEKIP
QVEVYFFVELYEATAGAAINNSARFAQIKILESDESQSLVYFSVGSRLAVAHKKATLISL
QVARDSGTGLMMSVNFSTQELRSAETIGRTIISPAISGKDFVITEGTLVFEPGQRSTVLD
VILTPETGSLNSFPKRFQIVLFDPKGGARIDKVYGTANITLVSDADSQAIWGLADQLHQP
VNDDILNRVLHTISMKVATENTDEQLSAMMHLIEKITTEGKIQAFSVASRTLFYEILCSL
INPKRKDTRGFSHFAEVTENFAFSLLTNVTCGSPGEKSKTILDSCPYLSILALHWYPQQI
NGHKFEGKEGDYIRIPERLLDVQDAEIMAGKSTCKLVQFTEYSSQQWFISGNNLPTLKNK
VLSLSVKGQSSQLLTNDNEVLYRIYAAEPRIIPQTSLCLLWNQAAASWLSDSQFCKVVEE
TADYVECACSHMSVYAVYAQTDNLSSYNEAFFTSGFICISGLCLAVLSHIFCARYSMFAA
KLLTHMMAASLGTQ
Download sequence
Identical sequences ENSGGOP00000020715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]