SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020727 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020727
Domain Number 1 Region: 1258-1473
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-49
Family ABC transporter ATPase domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 466-672
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-37
Family ABC transporter ATPase domain-like 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020727
Domain Number - Region: 788-876
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0162
Family Nuclear receptor ligand-binding domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020727   Gene: ENSGGOG00000013867   Transcript: ENSGGOT00000022373
Sequence length 1581
Comment pep:known_by_projection chromosome:gorGor3.1:5:14551735:14647979:1 gene:ENSGGOG00000013867 transcript:ENSGGOT00000022373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRKISVCQQTWALLCKNFLKKWRMKRESLMEWLNSLLLLLCLYIYPHSHQVNDFSSLL
TMDLGRVDTFNESRFSVVYTPVTNTTQQIMNKVASTPFLAGKEVLGLPDEESIKEFTANY
PEEIVRVTFTNTYSYHLKFLLGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVAL
QAAINAAIIEITTNHSVMEELMSVTGKNMKMHSFIGQSGVITDLYLFSCLISFSSFIYYA
SVNVTRERKRMKGLMTMMGLRDSAFWLSWGLLYAGFIFIMALFLAFVIKSTQFIILSSFM
VVFSLFLLYGLSLVALAFLMSILVKKSFLTGLVVFLLTVFWGCLGFTSLYRHLPASLEWI
LSLLSPFAFMLGMAQLLHLDYDLDSNAFPHPSDGSNLIVATNFMLAFDTCLYLALAIYFE
KILPNEYGHRRPPLFFLKSSFWSQTQKTDHVALEDEMDADPSSHDSFEPVPPEFQGKEAI
RIRNVTKEYKGKPDKIEALKDLVFDIYEGQITAILGHSGAGKSTLLNILSGLSVPTKGSV
TIYNNKLSEMADLENLSKLTGVCPQSNVQFDFLTVRENLRLFAKIKGILPQEVDKEIFLL
DEPTAGLDPFSRHQVWNLLKERKTDRVILFSTQFMDEADILADRKVFLSQGKLKCAGSSL
FLKKKWGIGYHLSLQLNEIFVEENITSLVKQHIPDAKLSAKSEGKLVYTLPLERTNKFPE
LYKDLDSYPDLGIENYGVSMTTLNEVFLKLEGKSTINESDIAILGEVQVEKADDTERLVE
MEQVLSSLNKMRKTIGGVALWRQQICTIARVRLLKLKHERKALLALLLILMAGFCPLLVE
YTMVKIYQNSYTWELSPHLYFLAPGQQPHDPLTQLLIINKTGASIDDFIHSVEHQNIALE
VDAFGTRNGTDDPSYNGAITVCGNEKNYSFSLACNAKRLNCFPVLMDIVSNGLLGMVKPS
VHIRTERSTFLENGQDNPIGFLAYIMFWLVLTSSCPPYIAMSSIDDYKNRARSQLRISGL
SPSAYWFGQALVDVSLYFLVFVFIYLMSYISNFEDMLLTIIHIIQIPCAVGYSFSLIFMT
YVISFIFRKGRKNSGIWSFCFYVITVFSVAGFAFNIFESDIPFIFTFLIPPATMIGCLFL
SSHLLFSSLFSEERMDVQPFLVFLIPFLHFIIFLFTLRCLEWKFGKKSMRKDPFFRISPR
SSDVCQNPEEPEGEDEDVQMERVRTANALNSTNFDEKPVIIASCLRKEYAGKRKGCFSKR
KNKIATRNVSFCVRKGEVLGLLGHNGAGKSTSIKVITGDTKPTAGQVLLKGSGGGDALEF
LGYCPQENALWPNLTVRQHLEVYAAVKGLRKEDAEVAITRLTDALKLQDQLKSPVKTLSE
GIKRKLCFVLSILGNPSVVLLDEPSTGMDPEGQQQMWQAIRATFRNTERGALLTTHYMAE
AEAVCDRVAIMVSGRLRCIGSIQHLKSKFGKDYLLEMKVKNLAQVEPLHAEILRLFPQAA
RQERYSSLMVYKLPVEDVQPLAQAFFKLEKVKQSFDLEEYSLSQSTLEQVFLELSKEQEL
GDFEEDFDPSVKWKLLPQEEP
Download sequence
Identical sequences ENSGGOP00000013549 ENSGGOP00000020727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]