SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020733 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020733
Domain Number 1 Region: 72-364
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 8.75e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000772
Further Details:      
 
Domain Number 2 Region: 371-510
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.4e-33
Family Ricin B-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020733   Gene: ENSGGOG00000014438   Transcript: ENSGGOT00000026408
Sequence length 522
Comment pep:known_by_projection chromosome:gorGor3.1:5:138285104:138410695:1 gene:ENSGGOG00000014438 transcript:ENSGGOT00000026408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENG
FNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRS
PPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDV
ITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEM
YYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFK
VWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRFMTK
IAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQ
VFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSG
SCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN
Download sequence
Identical sequences ENSGGOP00000020733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]