SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020772 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020772
Domain Number 1 Region: 368-571
Classification Level Classification E-value
Superfamily Cupredoxins 1.81e-59
Family Multidomain cupredoxins 0.00000000256
Further Details:      
 
Domain Number 2 Region: 23-210
Classification Level Classification E-value
Superfamily Cupredoxins 3.06e-53
Family Multidomain cupredoxins 0.00000000534
Further Details:      
 
Domain Number 3 Region: 213-357
Classification Level Classification E-value
Superfamily Cupredoxins 2.94e-47
Family Multidomain cupredoxins 0.0000000804
Further Details:      
 
Domain Number 4 Region: 574-718
Classification Level Classification E-value
Superfamily Cupredoxins 1.38e-45
Family Multidomain cupredoxins 0.0000000819
Further Details:      
 
Domain Number 5 Region: 732-905
Classification Level Classification E-value
Superfamily Cupredoxins 1.55e-43
Family Multidomain cupredoxins 0.0000000324
Further Details:      
 
Domain Number 6 Region: 915-1058
Classification Level Classification E-value
Superfamily Cupredoxins 6.11e-41
Family Multidomain cupredoxins 0.000000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020772   Gene: ENSGGOG00000009531   Transcript: ENSGGOT00000033293
Sequence length 1065
Comment pep:known_by_projection chromosome:gorGor3.1:3:149631685:149679495:-1 gene:ENSGGOG00000009531 transcript:ENSGGOT00000033293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILILGIFLFLYSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP
DRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFH
SHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYH
SHIDAPKDIASGLIGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYC
SEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH
GQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKS
SSKDNIRGKHVRHYYIAAEEIIWNYAPSGVDIFTKENLTAPGSDSAVFFEQGTTRIGGSY
KKLVYREYTDASFTSRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGV
RFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTKTFTYEWTVPKEVGPTNADPVCLAKMYY
SAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF
TTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLSMCKGDSVMWYLFSAGNEADVHGIYF
SGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRR
QSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYK
KVVYRQYTDSTFRIPVERKAEEEHLGILGLQLHADVGDKVKIIFKNMTTRPYSIHAHGVQ
TESSTLIPALPGETLTYLWKIPERSGAGTEDSACIPWAYYSTVDQVKGLYSGLIGPLIVC
RRPYLEVFNPRKKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHA
INGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFXXXX
XXXXXXXXXXXXXXIWLLHCHVTDHIHAGMETTYTVLQNEGEYPG
Download sequence
Identical sequences ENSGGOP00000009313 ENSGGOP00000020772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]