SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020774 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020774
Domain Number 1 Region: 209-299
Classification Level Classification E-value
Superfamily E set domains 2e-27
Family Filamin repeat (rod domain) 0.00000347
Further Details:      
 
Domain Number 2 Region: 83-170
Classification Level Classification E-value
Superfamily E set domains 0.0000000000434
Family Filamin repeat (rod domain) 0.0000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020774   Gene: ENSGGOG00000028406   Transcript: ENSGGOT00000027918
Sequence length 300
Comment pep:novel chromosome:gorGor3.1:7:127045664:127055759:-1 gene:ENSGGOG00000028406 transcript:ENSGGOT00000027918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPSSQGTPGLAPEEISLDAVAEGRPSAVETMEKLNFSVCREATWKPPNSEKKPTCYCE
QCNPKVTAEEAQRSSRPPRCPSGVSLQALGLAQCSLSSHRCVIRDHVNALNACLGTIDGP
SKVQLDCRECPEGHVVTDTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHE
TSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGT
NMMMVDVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIIKWGDESVPGSPFKVKIP
Download sequence
Identical sequences ENSGGOP00000020774 ENSGGOP00000020774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]