SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020791 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020791
Domain Number 1 Region: 1514-1626
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-47
Family Noncollagenous (NC1) domain of collagen IV 0.000000497
Further Details:      
 
Domain Number 2 Region: 1402-1511
Classification Level Classification E-value
Superfamily C-type lectin-like 1.04e-44
Family Noncollagenous (NC1) domain of collagen IV 0.000000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020791   Gene: ENSGGOG00000012523   Transcript: ENSGGOT00000028105
Sequence length 1627
Comment pep:known_by_projection chromosome:gorGor3.1:13:93410423:93475948:-1 gene:ENSGGOG00000012523 transcript:ENSGGOT00000028105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLP
GIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPG
MLLKGERGFPGIPGTPGPPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGLSFQGPK
GDKGDQGVSGPPGVPGQAQVQEKGDFATKGEKGQKGEPGFQGMPGVGEKGEPGKPGPRGK
PGKDGDKGEKGSPGFPGEPGYPGLIGRQGPQGEKGEAGPPGPPGIVSKSAVPGSVRALGE
EGEEPGSVRALGGGSATGFPGLPGQPGPPGLPVPGQAGAPGFPGERGEKGDRGFPGTSLP
GPSGRDGLPGPPGSPGPPGQPGYTNGIVECQPGPPGDQGPPGIPGQPGFIGEIGEKGQKG
ESCLICDIDGYRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGVAGVPGPQGTPGLIGQP
GAKGEPGEIYFDLRLKGDKGDPGFPGQPGMPGRAGSPGRDGHPGLPGPKGSPGSVGLKGE
RGPPGGVGFPGSRGDTGPPGPPGYGPTGPIGDKGQAGFPGGPGSPGLPGPKGEPGKVVPL
PGPPGAEGLPGSPGFPGPQGDRGFPGTPGRPGVPGEKGAVGQPGIGFPGPPGPKGVDGLP
GDMGPPGTPGRPGFNGLPGNPGVQGQKGEPGVGLPGLKGLPGLPGIPGTPGEKGSIGVPG
VPGEHGAIGPPGLQGIRGEPGPPGLPGSVGSPGVPGIGPPGARGPPGGQGPPGLSGPPGI
KGEKGFPGFPGLDMPGPKGDKGAQGLPGITGQSGLPGLPGQQGAPGIPGFPGSKGEMGVM
GTPGQPGSPGPVGAPGLPGEKGDHGFPGSSGPRGDPGLKGDKGDVGLPGKPGSMDKVDMG
SMKGQKGDQGEKGQIGPIGEKGSRGDPGTPGVPGKDGQAGQPGQPVLGPKGDPGISGTPG
APGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGSPGLPGDKGAKGEKGQAGPPGIGIPGL
RGEKGDQGIAGFPGSPGEKGEKGSIGIPGMPGSPGLKGSPGSVGYPGSPGLPGEKGDKGL
PGLDGIPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEPGLPGRGFPGFPGAK
GDKGSKGEVGFPGLAGSPGIPGSKGEQGFMGPPGPQGQPGLPGSPGHATEGPKGDRGPQG
QPGLPGLPGPMGPPGLPGIDGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGSPGITG
SKGDMGPPGVPGFQGPKGLPGLQGIKGDQGDQGVPGAKGLPGPPGPPGPYDIIKGEPGLP
GPEGPPGLKGLQGLPGPKGQQGVTGLVGIPGPPGIPGFDGAPGQKGEMGPAGPTGPRGFP
GPPGPDGLPGSMGPPGTPSVDHGFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERA
HGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIR
PFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPG
SCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRC
QVCMRRT
Download sequence
Identical sequences ENSGGOP00000020791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]