SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020798 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020798
Domain Number 1 Region: 126-181
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000233
Family SNARE fusion complex 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020798
Domain Number - Region: 5-118
Classification Level Classification E-value
Superfamily t-snare proteins 0.000119
Family t-snare proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020798   Gene: ENSGGOG00000001255   Transcript: ENSGGOT00000031205
Sequence length 212
Comment pep:novel chromosome:gorGor3.1:5:37154563:37170202:-1 gene:ENSGGOG00000001255 transcript:ENSGGOT00000031205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLYQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPP
NKRQNAKLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTANDSDTTIPM
DESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMR
LIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT
Download sequence
Identical sequences A0A2I2YTX4
ENSGGOP00000020798 XP_018882085.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]