SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020823 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020823
Domain Number 1 Region: 28-116
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-21
Family PDZ domain 0.00049
Further Details:      
 
Domain Number 2 Region: 295-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000454
Family LIM domain 0.0013
Further Details:      
 
Domain Number 3 Region: 263-294
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000178
Family LIM domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020823   Gene: ENSGGOG00000026407   Transcript: ENSGGOT00000026427
Sequence length 323
Comment pep:novel chromosome:gorGor3.1:14:30879127:30880117:1 gene:ENSGGOG00000026407 transcript:ENSGGOT00000026427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLHAMPHPACLSPRVVAHHSRAMTTQQLVLQGLGPWGFRLVGVKDFEQPLTISWVTPGSK
VALANLCIRDVITAIDGENSSNMTHLEAQNRIKGCKDNMTLTVARSEHKVWSPLVTEEEK
CRPYKMNLVSEPQEVLHIGSAHNRSSMPFTTSPASSTNARVITNQYNNPENISNFNNALE
SDCYQRGGGEHAQPPISLVIHKESEVCKMLQEKRELNEPPKQSVSFLVLQKILESEEKED
PNKPSGFRSVKAPVTKVAALIGNAQKLPMCDKCGPGIVGVFVKLRDRHRHPECYLCTDCC
TNLKQRGHFFVEDQIYCEKHAWE
Download sequence
Identical sequences ENSGGOP00000020823 ENSGGOP00000020823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]