SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020872 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020872
Domain Number 1 Region: 64-99
Classification Level Classification E-value
Superfamily GLA-domain 0.000000000000824
Family GLA-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020872   Gene: ENSGGOG00000010916   Transcript: ENSGGOT00000028415
Sequence length 100
Comment pep:known chromosome:gorGor3.1:1:135252591:135253748:1 gene:ENSGGOG00000010916 transcript:ENSGGOT00000028415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Download sequence
Identical sequences P02818 P84349
ENSP00000357255 9606.ENSP00000357255 gi|40316933|ref|NP_954642.1| ENSGGOP00000020872 ENSP00000357255 NP_954642.1.87134 NP_954642.1.92137 XP_004027004.1.27298 ENSP00000357255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]