SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020885 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020885
Domain Number 1 Region: 202-354
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 5.36e-38
Family Apolipoprotein A-I 0.0015
Further Details:      
 
Domain Number 2 Region: 132-214
Classification Level Classification E-value
Superfamily Apolipoprotein 1.7e-17
Family Apolipoprotein 0.0063
Further Details:      
 
Domain Number 3 Region: 24-64
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00000484
Family Apolipoprotein 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020885   Gene: ENSGGOG00000028447   Transcript: ENSGGOT00000024092
Sequence length 382
Comment pep:known_by_projection chromosome:gorGor3.1:11:114716684:114720277:-1 gene:ENSGGOG00000028447 transcript:ENSGGOT00000024092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLKAVVLTLALVAVTGARAEVSADQVAMVMWDYFSQLSNNAKEAVEHLQKSELTQQLKL
MEEREGGKCHTGPSGIKGREAPGHRQGKQHLVPLEDPSRGQEDNIVLHNVILWPRTLPLT
RRGKQTAGGDMDKLGEVNTQAEQLRRQLIPYTERMERVLRENADSLRASLRPHADELKAK
IDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEGLAFQMKKNA
EELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEP
YGENFNKALVQQMEQLRQKLGPYAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLS
LPGFPGRGLEQAKEEGKVPLEG
Download sequence
Identical sequences ENSGGOP00000020885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]