SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020886 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020886
Domain Number 1 Region: 750-916
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-47
Family MAM domain 0.00022
Further Details:      
 
Domain Number 2 Region: 238-329
Classification Level Classification E-value
Superfamily Immunoglobulin 3.11e-17
Family I set domains 0.0054
Further Details:      
 
Domain Number 3 Region: 343-442
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000474
Family I set domains 0.043
Further Details:      
 
Domain Number 4 Region: 438-540
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000518
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 535-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000841
Family I set domains 0.032
Further Details:      
 
Domain Number 6 Region: 48-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000117
Family I set domains 0.069
Further Details:      
 
Domain Number 7 Region: 131-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000811
Family I set domains 0.03
Further Details:      
 
Domain Number 8 Region: 194-240,632-740
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000006
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020886   Gene: ENSGGOG00000003747   Transcript: ENSGGOT00000027676
Sequence length 955
Comment pep:known_by_projection chromosome:gorGor3.1:6:38686669:38755037:-1 gene:ENSGGOG00000003747 transcript:ENSGGOT00000027676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQC
LVTGHPRPQVRWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIK
SIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDIYEPLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTAPP
ALKLSVNETLVVNPGENVTVQCLLTGGDPLPQLQWSHGPGPLPLGALAQGGTLSIPSVQA
QDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVD
AVPQEKVTYQWFKNGKPARMSKRLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCMASFP
GAPVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDK
EAALLPSGLPLEETPDGKLRLERVSRDMSGTYRCQTARYNGFNVRPREAQVQLNVQFPPE
VEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAEL
RLDAVTRDSSGSYECSVSNDVGSAACLFQVSAKAYSPEFYFDTPNPTRSHKLSKNYSYVL
QWTQREPDAVDPVLNYRLSIRQLNQHNAVVKAIPVRRVEKGQLLEYILTDLRVPHSYEVR
LTPYTTFGAGDMASRIIHYTEPINSPNLSDNTCHFEDEKICGYTQDLTDNFDWTRQNALT
QNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVSFFYHM
YGKHIGSLNLLVRSRNKGALDTHAWSLSGNKGNVWQQAHVPISPSGPFQIIFEGVRGPGY
LGDIAIDDVTLKKGECPRKQTDPNKVVVMPGSGVSCQSSPQLWGPMAIFLLALQR
Download sequence
Identical sequences G3RYJ7
ENSGGOP00000020886 XP_004043996.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]