SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020904 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020904
Domain Number 1 Region: 180-242
Classification Level Classification E-value
Superfamily RING/U-box 1.96e-20
Family RING finger domain, C3HC4 0.0033
Further Details:      
 
Domain Number 2 Region: 24-98
Classification Level Classification E-value
Superfamily PA domain 0.0000000144
Family PA domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020904   Gene: ENSGGOG00000001137   Transcript: ENSGGOT00000027142
Sequence length 346
Comment pep:known_by_projection chromosome:gorGor3.1:5:164529065:164608514:-1 gene:ENSGGOG00000001137 transcript:ENSGGOT00000027142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVYFFFFSVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYN
NKSKEEPVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNFSRGS
LVFVSISFIVLMIISSAWLIFYFIQKIRYTNARDRNQRRLGDAAKKAISKLTTRTVKKGD
KETDPDFDHCAVCIESYKQNDVVRILPCKHVFHKSCVDPWLSEHCTCPMCKLNILKALGI
VPNLPCTDNVAFDMERLTRTQAVNRRSALGDLAGDNSLGLEPLRTSGISPLPQDGELTPR
TGEINIAVTKEWFIIASFGLLSALTLCYMIIRATASLNANDKILYF
Download sequence
Identical sequences ENSGGOP00000020904 ENSGGOP00000020904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]