SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020923 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020923
Domain Number 1 Region: 144-455
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-104
Family Transglutaminase core 0.000000129
Further Details:      
 
Domain Number 2 Region: 4-143
Classification Level Classification E-value
Superfamily E set domains 2.66e-40
Family Transglutaminase N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 584-682
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.25e-23
Family Transglutaminase, two C-terminal domains 0.0014
Further Details:      
 
Domain Number 4 Region: 472-578
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000139
Family Transglutaminase, two C-terminal domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020923   Gene: ENSGGOG00000013478   Transcript: ENSGGOT00000025736
Sequence length 683
Comment pep:known_by_projection chromosome:gorGor3.1:3:46025223:46068796:1 gene:ENSGGOG00000013478 transcript:ENSGGOT00000025736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASKELQVLHIDFLKQDNAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQPLQSYHQLKLE
FSTGPNPSIAKHTLVVLDPRTPSDHYNWQATLQNESGKEVTVAVTSSPNAILGKYQLNVK
TGNHILKSEENILYLLFNPWCKEDMVFMPDEDERKEYILNDTGCHYVGAARSIKYKPWNF
GQFEKNVLDCCISLLTESSLKPTDRRDPVLVCRAMCAMMSFEKGQGMLIGNWTGDYEGGT
APYKWTGCAPILQQYYNTKQAVCFGQCWDPDYRIISVLRALGIPARSVTAFDSTHDTERN
LTVDTYVNENGEKITNMTHDSVWNFHVWTDAWMKRPDLPKGYDGWQAVDATPQERSQGVF
CCGPSPLTAICKGDIFIVYDTRFVFSEVNGDRLIWLVKMVNGQEELHVISMETTSIWKNI
STKAVGQDRWRDITYEYEYPEGSSEERQVMDHAFLLLSSEREHRRPVKENFLHMSVQSDD
VLLGNPVNFTVILKRKTAALQNVNISGSFELQLYTGKKVAKLCDLNKTSQIQGQVSEVTL
TLDSKTYINSLAILDDEPVIRGFIIAEIVESEEIMASEVFTSFQYPEFSIELPNTGRIGQ
LLVCNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHETVQPGETIQSQIKCTPIKTGPKK
FIVKLSSKQVKEINAQKIVLITK
Download sequence
Identical sequences ENSGGOP00000013152 ENSGGOP00000020923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]