SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020927 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020927
Domain Number 1 Region: 353-404,442-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000322
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 594-665
Classification Level Classification E-value
Superfamily EF-hand 0.0000394
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020927   Gene: ENSGGOG00000001841   Transcript: ENSGGOT00000034249
Sequence length 803
Comment pep:known_by_projection chromosome:gorGor3.1:10:113768414:113810759:-1 gene:ENSGGOG00000001841 transcript:ENSGGOT00000034249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVGSPEGQELQKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGPLQPQPKKPEDEPQET
AYRTRVSSCCLHICQGIRGLWGTTLTENTAENRELYVKTTLRELLVYIVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTPSDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSL
GHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPF
NGTAWTYHSQDELGGSSHWGRLTSYSGGGYYLDLPGSRQGSAEALRDLQEGLWLDRGTRV
VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVIFC
VFIFYYVVEEILELHIHRLRYLSSIWNILDMVVILLSIVAVGFHIFRTLEVNRLMGKLLQ
QPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKVFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKE
RVSDMQKVLQGGEQKIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEK
MRQDLEEERVALNTEIEKLGRSIVSSPQGESGPEAARAGGWVSEEFYMLTRRVLQLETVL
EGVVSQIDAVGSKLKMLERKGSLPRRGEKEQAIWKHPQPAPAVTPDPWGVQGGQESEVPY
KREEEALEERRLSHGEIPMMQRS
Download sequence
Identical sequences ENSGGOP00000020927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]