SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020947 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020947
Domain Number 1 Region: 100-202
Classification Level Classification E-value
Superfamily TAFH domain-like 2.09e-39
Family TAFH domain-like 0.00000134
Further Details:      
 
Domain Number 2 Region: 492-534
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000126
Family MYND zinc finger 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020947
Domain Number - Region: 426-500
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.000929
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020947   Gene: ENSGGOG00000002874   Transcript: ENSGGOT00000030142
Sequence length 584
Comment pep:known_by_projection chromosome:gorGor3.1:8:90797934:90856197:-1 gene:ENSGGOG00000002874 transcript:ENSGGOT00000030142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCHLCCTFLNRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGT
SHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDI
SPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCA
RLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHS
EHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSH
RDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRR
CQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGY
VPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAED
ALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQ
GDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
Download sequence
Identical sequences ENSGGOP00000020947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]