SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020982 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020982
Domain Number 1 Region: 91-219
Classification Level Classification E-value
Superfamily Cupredoxins 7.62e-56
Family Periplasmic domain of cytochrome c oxidase subunit II 0.0000034
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 2.13e-29
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020982   Gene: ENSGGOG00000028325   Transcript: ENSGGOT00000028370
Sequence length 227
Comment pep:known chromosome:gorGor3.1:MT:7009:7692:1 gene:ENSGGOG00000028325 transcript:ENSGGOT00000028370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAAQVGLQDATSPIMEELIIFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METIWTILPAIILVLIALPSLRILYMTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLEPGDLRLLDVDNRVVLPVEAPVRMMITSQDVLHSWAVPTLGLKTDAIPGRLN
QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFAL
Download sequence
Identical sequences G3RYU2
YP_002120662.1.27298 ENSGGOP00000020982 ENSGGOP00000020982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]