SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020984 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020984
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-40
Family Galectin (animal S-lectin) 0.0000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020984   Gene: ENSGGOG00000021929   Transcript: ENSGGOT00000029567
Sequence length 139
Comment pep:known_by_projection chromosome:gorGor3.1:19:36992922:36997856:1 gene:ENSGGOG00000021929 transcript:ENSGGOT00000029567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLPVPYKLPVSLSVGSCVIIKGTPIDSFINDPQLQVDFYTDMDEDSDIAFCFRVHFGN
HVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSF
VKMVQVSRDISLTPVCVCN
Download sequence
Identical sequences G3RYU4
ENSGGOP00000020984 XP_004060771.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]