SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020995 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020995
Domain Number 1 Region: 110-460
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.69e-114
Family PDEase 0.000000248
Further Details:      
 
Domain Number 2 Region: 6-86
Classification Level Classification E-value
Superfamily GAF domain-like 2.06e-19
Family GAF domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020995   Gene: ENSGGOG00000024241   Transcript: ENSGGOT00000030560
Sequence length 466
Comment pep:novel chromosome:gorGor3.1:10:106849477:106888977:-1 gene:ENSGGOG00000024241 transcript:ENSGGOT00000030560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEYITETLTQFLGWSL
LNTDTYDKMNKLENRKDIAQEMLMNQTKATPEEIKSILKFQEKLNVDIIDDCEEKQLVAI
LKEDLPDPRSAELYEFRFSDFPLTEHGLIKCGIRLFFEINVVEKFKVPVEVLTRWMYTVR
KGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLY
QMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFETVIHLFEVAIIATD
LALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMTACDLSAITKPWEV
QSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFIDFVCTFVYKEFSR
FHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEK
Download sequence
Identical sequences ENSGGOP00000020995 ENSGGOP00000020995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]