SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020999 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020999
Domain Number 1 Region: 63-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000314
Family LIM domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020999   Gene: ENSGGOG00000023886   Transcript: ENSGGOT00000028067
Sequence length 135
Comment pep:novel chromosome:gorGor3.1:2a:107745032:107765865:1 gene:ENSGGOG00000023886 transcript:ENSGGOT00000028067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSGRARPCVIPENEEIPRAALNSVHEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAK
FNMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEQEGADC
RCTGAERGAILPAMP
Download sequence
Identical sequences ENSGGOP00000020999 ENSGGOP00000020857 ENSGGOP00000020999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]