SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021018 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021018
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Globin-like 1.99e-42
Family Globins 0.000000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021018   Gene: ENSGGOG00000028344   Transcript: ENSGGOT00000025952
Sequence length 117
Comment pep:known_by_projection chromosome:gorGor3.1:10:142576621:142577865:1 gene:ENSGGOG00000028344 transcript:ENSGGOT00000025952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLS
ELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQAQAAYQKVVAGVANALAHKYH
Download sequence
Identical sequences ENSGGOP00000021018 ENSGGOP00000020813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]