SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021040 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021040
Domain Number 1 Region: 414-454
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000401
Family LIM domain 0.00027
Further Details:      
 
Domain Number 2 Region: 380-413
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000764
Family LIM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021040   Gene: ENSGGOG00000007975   Transcript: ENSGGOT00000029608
Sequence length 757
Comment pep:known_by_projection chromosome:gorGor3.1:12:48130506:48207582:-1 gene:ENSGGOG00000007975 transcript:ENSGGOT00000029608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSPFNRRQWTSLSLRVTAKELSLVNKNKSSAIVEIFSKYQKAAEETNMEKKRSNTENL
SQHFRKGTLTVLKKKWENPGLGAESHTDSLRNSSTEIRHRADHPPAEVTSHAASGAKADQ
EEQIHPRSRLRSPPEALVQGRYPHIKDGEDLKDHSTESKKMENCLGESRHEVEKSEISEN
TDASGKIEKYNVPLNRLKMMFEKGEPTQTKILRAQSRSASGRKVSENSYSLDDLEIGPGQ
LSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSKQSSSTNYTSETPSQKKKKSI
WELQKNIPSVEISPSLSQEHSLISANENSLAVRSTPAEDDSCDSQVKSEVQQPVHPKPLS
PDSRASSLSESSPPKAIKKFQAPARETCVECQKTVYPMERLLANQQVFHISCFRCSYCNN
KLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHRPHKDLWASKNENEEILERPAQLA
NARETPHSPGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSG
SALDEGIKVSKPKWPPEDEISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASFQSTSI
RSPKTVSPPIRKGWSMSEQSEESVGGRVAERKQVENAKASKKNGNVGKTTWQNKESKGET
GKRSKEGHSLEMENENLVENGADSDEDDNSFLKQQSPQEPKSPNWSSFVDNTFAEEFTTQ
NQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE
Download sequence
Identical sequences ENSGGOP00000021040 ENSGGOP00000007803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]