SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021045 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021045
Domain Number 1 Region: 67-197,266-524
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 1.7e-96
Family Proton glutamate symport protein 0.0000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021045   Gene: ENSGGOG00000013450   Transcript: ENSGGOT00000029492
Sequence length 567
Comment pep:known_by_projection chromosome:gorGor3.1:19:15230619:15261360:-1 gene:ENSGGOG00000013450 transcript:ENSGGOT00000029492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSSHGNSLFLRESGQRLGRVGWLQRLQESLQQRALRTRLRLQTLTREHVLRFLRRNAFI
LLTVSAVVIALGVSLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSLVTGMA
SLDNKATGRMGMRAAVYYMVTTIIAVFIGILMVTIIHPGKGSKEGLHREGRIETIPTADA
FMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFL
ENVTRALGTLQEVLSFEETVPVPGSANGINALGLVVFSVAFGLVIGGMKHKGRVLRDFFD
SLNEAIMRLVGIIIWYAPVGILFLIAGKILEMEDMAVLGGQLGMYTLTVIVGLFLHAGIV
LPLIYFLVTHRNPFPFIGGMLQALITAMGTSSSSATLPITFRCLEEGLGVDRRITRFVLP
VGATVNMDGTALYEALAAIFIAQVNNYELNLGQITTIRLGGLGREEGAAAGAQRSPRMLE
GGCGKSPMPDEDIAVILGNAYLDDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLP
SLGKPYKSLMAQEKGASRGRGGNESAM
Download sequence
Identical sequences ENSGGOP00000021045 ENSGGOP00000013117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]