SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021070 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000021070
Domain Number - Region: 175-200
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00102
Family CCCH zinc finger 0.0034
Further Details:      
 
Domain Number - Region: 17-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0251
Family CCCH zinc finger 0.0039
Further Details:      
 
Domain Number - Region: 211-234
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0445
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021070   Gene: ENSGGOG00000007756   Transcript: ENSGGOT00000033955
Sequence length 354
Comment pep:known_by_projection chromosome:gorGor3.1:X:129891401:129952612:-1 gene:ENSGGOG00000007756 transcript:ENSGGOT00000033955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKG
RCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMT
PSLPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVC
REFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQA
RLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLP
QPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQLKF
Download sequence
Identical sequences A0A2I3TFH5 G3QXN2
ENSGGOP00000021070 ENSPTRP00000038382 XP_003317735.1.37143 XP_003814537.1.60992 XP_004064923.1.27298 ENSPTRP00000038382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]