SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021101 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021101
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily EF-hand 2.79e-22
Family S100 proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021101   Gene: ENSGGOG00000028087   Transcript: ENSGGOT00000025286
Sequence length 108
Comment pep:known chromosome:gorGor3.1:1:132375580:132378330:-1 gene:ENSGGOG00000028087 transcript:ENSGGOT00000025286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTPVEESLFQIIHCFHQYAARQGDMETLSLQELQALLMDNMPRFMDSLGQKEPYYVTE
LFQATDKNRDNQICFDEFLYILGKLVKDYHLQYHRQLCARYCAQHSLY
Download sequence
Identical sequences A7K6Y8
ENSGGOP00000021101 ENSGGOP00000021101 ENSGGOP00000024236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]