SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021116 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021116
Domain Number 1 Region: 382-626
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.12e-92
Family Eukaryotic proteases 0.000000725
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021116
Domain Number - Region: 127-154
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000412
Family Pan module (APPLE domain) 0.055
Further Details:      
 
Domain Number - Region: 299-341
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00412
Family Pan module (APPLE domain) 0.028
Further Details:      
 
Domain Number - Region: 222-262
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.012
Family Pan module (APPLE domain) 0.081
Further Details:      
 
Domain Number - Region: 41-64
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0122
Family Pan module (APPLE domain) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021116   Gene: ENSGGOG00000026546   Transcript: ENSGGOT00000022337
Sequence length 638
Comment pep:known_by_projection chromosome:gorGor3.1:4:197068506:197099062:1 gene:ENSGGOG00000026546 transcript:ENSGGOT00000022337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILFKQATYFISLFATVSCGCLTQLYENTFFRGGDVASMYTPNAQYCQMMCTFHPRCLLF
SFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVD
MRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHNAEYRNNCLLKYSPRGTPTAIK
VLSNVESGFSLKPCALSEIGCHMNVFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFF
TFYTNAWKVESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGV
DFGGEELNVTFVKGVDVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRI
VYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCG
GSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEG
NHDIALIKLQAPLNYTEFQKPICLPSKGDTNTIYTNCWVTGWGFSKEKGEIQNILQKVNI
PLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGE
GCARREQPGVYTKVAEYMDWILEKMQSSDGKARMQSPA
Download sequence
Identical sequences G3RZ73
ENSGGOP00000021116 ENSGGOP00000021116 XP_018881331.1.27298 XP_018881332.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]