SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021139 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021139
Domain Number 1 Region: 355-637
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.53e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 178-354
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.1e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000902
Further Details:      
 
Domain Number 3 Region: 639-745
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.02e-27
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 145-176
Classification Level Classification E-value
Superfamily TGS-like 0.0000222
Family TGS domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021139
Domain Number - Region: 83-111
Classification Level Classification E-value
Superfamily TGS-like 0.0654
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021139   Gene: ENSGGOG00000014336   Transcript: ENSGGOT00000029630
Sequence length 756
Comment pep:known_by_projection chromosome:gorGor3.1:17:60240420:60267418:-1 gene:ENSGGOG00000014336 transcript:ENSGGOT00000029630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEM
YNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISHTASCINLSS
LASLLASVAISSSGMPWPPLFSLQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDE
EAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCK
KIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVR
HTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIG
RDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSG
HWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSG
ALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLG
DIEVWDQAEKQLENSLNEFGEKWELNAGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQL
PIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENFGGKWPFWLSPRQVMVVPVG
PTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVN
IRTRDNKVHGERTISETIERLQQLKEFRSKQAEEEF
Download sequence
Identical sequences G3RZ96
ENSGGOP00000021139 ENSGGOP00000021139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]