SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021142 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021142
Domain Number 1 Region: 310-369
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000773
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 96-120
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000366
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021142
Domain Number - Region: 241-263
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000392
Family CCCH zinc finger 0.0049
Further Details:      
 
Domain Number - Region: 395-424
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000549
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021142   Gene: ENSGGOG00000013279   Transcript: ENSGGOT00000013327
Sequence length 507
Comment pep:known_by_projection chromosome:gorGor3.1:15:2570412:2572738:1 gene:ENSGGOG00000013279 transcript:ENSGGOT00000013327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPAAPSEAHEAAGAQAGAEAAREGVSGPDLPVCEPSGESAAPDSALPHAARGWAPFPV
APVPAHLRRGGLRPAPASGGGAWPSPLPSRSSGIWTKQIICRYYIHGQCKEGENCRYSHD
LSGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGLAAERGFF
EAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPLQSSETERKQMAVGSG
LRFCYYASRGVCFRGESCMYLHGDICDMCGLQTLHPMDAAQREEHMRACIEAHEKDMELS
FAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHSFCIRCIRRWRSARQFENRIVKS
CPQCRVTSELVIPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH
EYPEGWGDEPPGPGGGSFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLS
LRDELPFSEDQWDLLHYELEEYFNLIL
Download sequence
Identical sequences XP_004055886.1.27298 ENSGGOP00000021142 ENSGGOP00000021142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]