SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021155 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021155
Domain Number 1 Region: 5-129
Classification Level Classification E-value
Superfamily L domain-like 1.55e-26
Family U2A'-like 0.000000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021155   Gene: ENSGGOG00000028077   Transcript: ENSGGOT00000029259
Sequence length 232
Comment pep:known_by_projection chromosome:gorGor3.1:15:81422534:81434169:-1 gene:ENSGGOG00000028077 transcript:ENSGGOT00000029259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHFIGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGL
DQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVR
VLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEA
IKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS
Download sequence
Identical sequences ENSGGOP00000021155 ENSGGOP00000021155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]