SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021158 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000021158
Domain Number - Region: 13-38,71-138,174-203
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0282
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021158   Gene: ENSGGOG00000024869   Transcript: ENSGGOT00000026274
Sequence length 259
Comment pep:novel chromosome:gorGor3.1:16:71585185:71602306:-1 gene:ENSGGOG00000024869 transcript:ENSGGOT00000026274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFQGKRMRKQTWGYFRSKWNLLELAIILASWSALAVFVKRAALAERDLQRCRNHREEGI
SFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNLKMNMITAALHRAWGDISGFIIVILT
MLLAYSIASNLIFGWKLRSYKTLFDAAETMISLQLGIFNYEEVLDYSPVLGSFLIGSCIV
FMTFVVLNLFISVILVAFSEEQKYYQLSEEGEIVDLLLMKILSFLGIKCKREDPGSSREQ
LGSLSQTRHSQPAQALPKV
Download sequence
Identical sequences ENSGGOP00000021158 ENSGGOP00000021158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]