SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021162 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021162
Domain Number 1 Region: 94-307,352-503
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.46e-81
Family Protein serine/threonine phosphatase 0.00000209
Further Details:      
 
Domain Number 2 Region: 484-642
Classification Level Classification E-value
Superfamily EF-hand 5.78e-19
Family Parvalbumin 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021162   Gene: ENSGGOG00000003393   Transcript: ENSGGOT00000033406
Sequence length 652
Comment pep:known_by_projection chromosome:gorGor3.1:X:18742961:18840363:1 gene:ENSGGOG00000003393 transcript:ENSGGOT00000033406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCVSLSTCILSMSAALRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLST
FFSFMLENYTHIHKEELELRNQSLESEQDLRDRWDYVDSIDVPDSYNGPRLQFPLTCTDI
DLLLEAFKEQQMLLLEYIKNMALKSYIIAKSLRDWTEKVIEALDAVPTIGDLHGKLDDLF
LIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNL
RYGFTKEILRKYKLHGKRILQILEELYAWLPIGTVVDNEILVIHGGISETTDLNLLHRVE
RNKMKSVLIPPAETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTKHEWEQIIDILW
SDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTI
FSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPLRQRVDTMENSAIKILRERV
ISRKSDLTRAFQLQDHRKSAKLDHRIINGSLRELLKLTKPWREREREKKNKYRNSLYEYM
SSFQNIRIEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISMEEFRAMWKLFSSH
YNVLIDDSQVNKLANIMDLNKDGSIDFNEFLKAFYVVHRYEDLMKPDVTNLG
Download sequence
Identical sequences ENSGGOP00000021162 ENSGGOP00000021162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]