SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021175 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021175
Domain Number 1 Region: 291-463,501-660
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.19e-135
Family Mammalian PLC 0.0000000336
Further Details:      
 
Domain Number 2 Region: 892-946,986-1138
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 6.54e-59
Family C-terminal domain of PLC-beta 0.0013
Further Details:      
 
Domain Number 3 Region: 117-290
Classification Level Classification E-value
Superfamily EF-hand 2.02e-52
Family EF-hand modules in multidomain proteins 0.00049
Further Details:      
 
Domain Number 4 Region: 5-116
Classification Level Classification E-value
Superfamily PH domain-like 4.15e-34
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 5 Region: 682-797
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.18e-27
Family PLC-like (P variant) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021175   Gene: ENSGGOG00000008419   Transcript: ENSGGOT00000022255
Sequence length 1153
Comment pep:known_by_projection chromosome:gorGor3.1:20:9551206:9695406:1 gene:ENSGGOG00000008419 transcript:ENSGGOT00000022255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYKRESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVLECSLINSIRSGAIPKDPKILAALE
AVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPEVTKQWVEGLRSIIHNFRANNVSPM
TCLKKHWMKLAFMTNTNGKIPVRSPSITRTFASGKTEKVIFQALKELGLPSGKNDEIEPT
AFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVDQLVSFLNEHQRDPRLNEILFPF
YDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDENAPVFLDRLELYQEMDHPLAHY
FISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELDCWDGKGEDQEPIITHGKAMCTD
ILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKMSKYCEDLFGDLLLKQALESHPL
EPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALRSMMEAGESASPANILEDDNEEEIE
SADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLVTVEDEQAWMASYKYVGATTNIH
PYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRI
YPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRR
PDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRM
VMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNKLIGQRILPLDGLQAGYRHISLR
NEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFLSITEKRADQMRAMGIERSDI
ADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAALASGVEAKKGIELIPQVRIEDL
KQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKA
MKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLH
LSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQAKISMENSKAISQDKSIKNKAE
RERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQLEHLEFLEKQNEQAKEMQQMVK
LEAEMDRRPATVV
Download sequence
Identical sequences ENSGGOP00000021175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]