SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021184 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021184
Domain Number 1 Region: 519-693
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.06e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 2 Region: 671-770
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.38e-17
Family Ypt/Rab-GAP domain of gyp1p 0.025
Further Details:      
 
Domain Number 3 Region: 838-1029
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000567
Family Calmodulin-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021184   Gene: ENSGGOG00000025415   Transcript: ENSGGOT00000024303
Sequence length 1178
Comment pep:known_by_projection chromosome:gorGor3.1:X:104117908:104188630:1 gene:ENSGGOG00000025415 transcript:ENSGGOT00000024303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPTWERREGWGKCGKPEPELLSPEEDLVGGEAEGKRRVESEVRRASRSLLPGGTKFAMW
LKPEEVLLKNALKLWLMERSNDYFVLQRRRGYGEEGGGGLTGLLVGTLDSVLDSTAKVAP
FRILHQTPDSQVYLSIACGANREEITKHWDWLEQNIMKTLSVFDSNEDITNFVQGKIRGL
IAEEGKHCFAKEDDPEKFREALLKFEKCFGLPEKEKLVTYYSCSYWKGRVPCQGWLYLST
NFLSFYSFLLGSEIKLIISWDEVSKLEKTSNVILTESIHVCSQGENHYFSMFLHINQTYL
LMEQLANYAIRRLFDKETFDNDPVLYNPLQITKRGLENRAHSEQFNAFFRLPKGESLKEV
HECFLWVPFSHFNTHGKMCISENYICFASQDGNQCSVIIPLREVLAIDKTNDSSKSVIIS
IKGKTAFRFHEVKDFEQLVAKFRLRCGATSTQYHDISTELAISSESTEPSDNFEVQSLTS
QRECSKTVNTEALMTVFHPQNLETLNSKMLKEKMKEQSWKILFAECGRGVSMFRTKKTRD
LVVRGIPETLRGELWMLFSGAVNDMATNPGYYTEVVEQSLGTCNLATEEIERDLRRSLPE
HPAFQSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCERM
LPDYFNRRIIGALVDQAVFEELIRDHLPQLTEHMTDMTFFSSVSLSWFLTLFISVLPIES
AVNVVDCFFYDGIKAILQLGLAILDYNLDKLLTCKDDAEAVTALNRFFDNVTNKDSPLPS
NVQQGSNVSDEKTSHTRVDITDLIRESNEKYGNIRYEDIHSMRCRNRLYVIQTLEETTKQ
NVLRVVSQDVKLSLQELEELYVIFKKELFLSCYWCLGCPVLKHHDPSLPYLEQYQIDCQQ
FRVLYHLLSPWAHSANKDSLALWTFRLLDENSDCLINFKEFSSAIDIMYNGSFTEKLKLL
FKLHIPPAYTEVKSKDASKGDELSKEELLYFSQLHVSKPANEKEAESAKHSPEKGKGKID
IQAYLSQWQDELFKKEENIKDLPRMNQSQFIQFSKTLYNLFHEDPEEESLYQAIAVVTSL
LLRMEEVGRKLHSPTSSAKGFSGTVCGSGGPSEEKTGSHLEKDPCSFREEPQWSFAFEQI
LASLLNEPALVRFFEKPIDVKAKLENARISQLRSRTKM
Download sequence
Identical sequences ENSGGOP00000021184 ENSGGOP00000021184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]