SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021291 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021291
Domain Number 1 Region: 118-438
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.77e-46
Family Amylase, catalytic domain 0.0024
Further Details:      
 
Domain Number 2 Region: 441-527
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000684
Family alpha-Amylases, C-terminal beta-sheet domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021291   Gene: ENSGGOG00000011233   Transcript: ENSGGOT00000028026
Sequence length 532
Comment pep:known_by_projection chromosome:gorGor3.1:11:59670674:59678249:1 gene:ENSGGOG00000011233 transcript:ENSGGOT00000028026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGTMSQDTEVDMKEVELNELEPEKQPMNAASGAAISLAGAEKNGLVKIKVAEDEAEAAAA
AKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKW
WHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLL
QIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWL
QAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDL
LLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCTWSLSQARLLTSFLPAQLLRLYQLMLF
TLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGS
LLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGL
QASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYVA
Download sequence
Identical sequences ENSGGOP00000021291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]