SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021384 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021384
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000113
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021384
Domain Number - Region: 77-114
Classification Level Classification E-value
Superfamily Orange domain-like 0.000392
Family Hairy Orange domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021384   Gene: ENSGGOG00000010276   Transcript: ENSGGOT00000029173
Sequence length 163
Comment pep:known_by_projection chromosome:gorGor3.1:1:2457841:2459007:-1 gene:ENSGGOG00000010276 transcript:ENSGGOT00000029173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFKEPKAPE
AHSRRRPPRAWTRPSPEGSGPKLAGPQEPHSQRMARSCWAYPW
Download sequence
Identical sequences ENSGGOP00000021384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]