SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021398 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021398
Domain Number 1 Region: 194-337
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-44
Family Dual specificity phosphatase-like 0.00000101
Further Details:      
 
Domain Number 2 Region: 7-131
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 8.79e-20
Family Cell cycle control phosphatase, catalytic domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021398   Gene: ENSGGOG00000015273   Transcript: ENSGGOT00000029534
Sequence length 375
Comment pep:known_by_projection chromosome:gorGor3.1:X:151620914:151624306:1 gene:ENSGGOG00000015273 transcript:ENSGGOT00000029534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLGRSCLWLRRELSPPRPRLLLLDCRSRELYESARIGGALSVALPALLLRRLRRGSLS
VRALLPGPPLQPPPPAPVLLYDEAEAEAEEWEAESVLGTLLQKLREEGYLAYYLQGGFSR
FQAECPHLCETSLGGRAGSSMAPVPSPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDS
EGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGD
FHYKQIPISDHWSQNLSQFFPEAIEFIDEALSQNCGVLVHCLAGVSRSVTVTVAYLMQKL
HLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQASAASNPPSF
FTTPTSDGAFELAPT
Download sequence
Identical sequences ENSGGOP00000021398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]