SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021410 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021410
Domain Number 1 Region: 4-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000157
Family Erythroid transcription factor GATA-1 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021410   Gene: ENSGGOG00000023375   Transcript: ENSGGOT00000025098
Sequence length 239
Comment pep:known_by_projection chromosome:gorGor3.1:7:89709113:89718240:1 gene:ENSGGOG00000023375 transcript:ENSGGOT00000025098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTFASTSATPPQSNGGGGGKQSKQEIHR
RSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQ
IGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFDPASYIIGPEE
DLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKETVANHL
Download sequence
Identical sequences ENSGGOP00000021410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]