SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021469 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021469
Domain Number 1 Region: 14-132
Classification Level Classification E-value
Superfamily L domain-like 1.28e-21
Family U2A'-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021469   Gene: ENSGGOG00000022265   Transcript: ENSGGOT00000027381
Sequence length 180
Comment pep:novel chromosome:gorGor3.1:15:60931522:60932170:-1 gene:ENSGGOG00000022265 transcript:ENSGGOT00000027381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VREHVLDNCKSNDWKIESLTAEFVNLEFLRLINVGLISISNLPKLPKLKKFVLSENRIFG
GLNMFAEKLPNLTHLNLSGKNLKDISTLEPLKKLDCLKSLDLFNCEVINLNDYQEGVFKL
LPQLTCLDTYDPEDREAPDSDAQDGEEEELDEEEDEDEDVEGDDDKDEMDEDEDEDEEEE
Download sequence
Identical sequences ENSGGOP00000021469 ENSGGOP00000021469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]