SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021480 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021480
Domain Number 1 Region: 302-435
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-28
Family C-type lectin domain 0.00085
Further Details:      
 
Domain Number 2 Region: 14-200
Classification Level Classification E-value
Superfamily PR-1-like 1.96e-18
Family PR-1-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021480   Gene: ENSGGOG00000024401   Transcript: ENSGGOT00000025625
Sequence length 445
Comment pep:novel chromosome:gorGor3.1:16:64745972:64759396:-1 gene:ENSGGOG00000024401 transcript:ENSGGOT00000025625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHPETSPGWGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRS
WVQPPAADMRRLDLGHSLASCCHRDQEPQEEPDPLLQAQTRWQCFQLRYNHILYMSFIVS
TGEFVSLFLYIDHLCYFQAVANSKTLNWFADLVWATSSQLGCGRHLCSAGQAAIEAFVCA
YSPGGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHGR
LNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPFHT
CDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGRLETTNEVID
SDFETTNFWIGLTYKTAKDSFRWATGEHQAFTSFGFGQPDNHGFGNCVELQASAAFNWND
QRCKTRNRYICQFAQEHISRWGPGS
Download sequence
Identical sequences ENSGGOP00000009522 ENSGGOP00000021480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]