SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021482 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021482
Domain Number 1 Region: 189-289,401-498,905-1118
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 4.32e-51
Family Calcium ATPase, transmembrane domain M 0.013
Further Details:      
 
Domain Number 2 Region: 697-757,805-891
Classification Level Classification E-value
Superfamily HAD-like 6.61e-27
Family Meta-cation ATPase, catalytic domain P 0.005
Further Details:      
 
Domain Number 3 Region: 605-712
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 9.81e-16
Family Metal cation-transporting ATPase, ATP-binding domain N 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021482
Domain Number - Region: 341-402
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0955
Family Calcium ATPase, transduction domain A 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021482   Gene: ENSGGOG00000016250   Transcript: ENSGGOT00000034506
Sequence length 1163
Comment pep:known_by_projection chromosome:gorGor3.1:1:17502113:17524586:-1 gene:ENSGGOG00000016250 transcript:ENSGGOT00000034506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSTDSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPWRVIGYHVVVWMMAGI
PLLLFRWKPLWGVRLRLRPCSLAHAETLVIEIRDKEDSSWKLFTVQVQTEAIGEGSLEPS
PQAQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAKRVLRYYLFQGQRYIWIETQQAFYQV
SLLDHGRSCDDIHRSRHGLSLQDQMVRKAIYGPNVISIPVKSYPQLLVDEPEHLWGPQRH
ALEAMWSSAYSFLHSASIYQVSIPSVCLSALRTRDSSNRTPDMLKTGAKVIKIPDGTGEW
EALSQNMMPTCALSDPPAGGWELAATCFQECLPVPLYLRRESIPVLKTALPEGLGPYCAE
THRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAKGGLVSSILHPRPINFKFYKHSMK
FVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALDLVTVVVPPALPAAMTVCTLYSQSR
LRRQGIFCIHPLRINLGGKLQLVCFDKVGPQVGLVQGSGTATGAPVRPPHPRYSLSSTHR
MPGVSPTKISDPGVHKGAAGAEGWAVLEEEPAADSAFGTQVLAVMRPPFWEPQLQAMEEP
PVPVSVLHRFPFSSALQRMSVVVAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQ
SYTAAGYRVVALASKPLPTVPSLEAAQQLTRDTVEGELSLLGLLVMRNLLKPQTTPVIQA
LRRTRIRAVMVTGDNLQTAVTVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPT
AVNGIKDPDQAASYAVEPDPRSRHLALSGPTFGIIVKHFPKLLPKVLVQGTVFARMAPEQ
KTELVCELQKLQYCVGMCGDGANDCGALKVADVGISLSQAEASVVSPFTSSMASIECVPM
VIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLM
SRTGPALVLGRVRPPXGALLSVPVLSSLLLQVALVTGVQLGGYFLTLAQPWFVPLNRTVP
APDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPFLVALALLSSILVGLVL
VPGLLQGPLALRNITDTCFKLLLLGLVTFNFVGAFMLESVLDQCLPACLRHLRPKRASKK
RFKQLERELAEQPWPPLPAGPLR
Download sequence
Identical sequences ENSGGOP00000021482 ENSGGOP00000015868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]