SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021515 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021515
Domain Number 1 Region: 7-84,178-248
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000442
Family Calmodulin-like 0.089
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021515
Domain Number - Region: 854-903
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.000183
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0022
Further Details:      
 
Domain Number - Region: 222-349
Classification Level Classification E-value
Superfamily EF-hand 0.00374
Family Calmodulin-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021515   Gene: ENSGGOG00000005976   Transcript: ENSGGOT00000032805
Sequence length 1379
Comment pep:known_by_projection chromosome:gorGor3.1:14:31561687:31671628:-1 gene:ENSGGOG00000005976 transcript:ENSGGOT00000032805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLG
RVHFDQFKEALILILSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQESVEEF
PEVTVIEPLDEEARPSHIPASDCSEHWKTQRSEEYEAEGQLRFWNPDDLNASQSGSSPPQ
DWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQNVDGEMLEEVFHNLDPDGTMSVE
DFFYGLFKNGKSLTPSASTPYRQLKRHLSMQSFDESGRRTTTSSAMTSTIGFRVFSCLDD
GMGHASVERILDTWQEEGIENSQEILKALDFSLDGNINLTELTLALENELLVTKNSIHQA
ALASFKAEIRHLLERVDQVVREKEKLRSDLDKAEKLKSLMASEVDDHHAAIERRNEYNLR
KLDEEYKERIAALKNELRKEREQILQQAGKQRLELEQEIEKAKTEENYIRDRLALSLKEN
SRLENELLENAEKLAEYENLTNKLQRNLENVLAEKFGDLDPSSAEFFLQEERLTQMRNEL
LVFKSQVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEELDANSGSIEPEHGLGSEECN
PLNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCEKAQENMKQRHE
NETHTLEKQISDLKNEIAELQGQAALLKEAHHEATCRHEEEKKQLQVKLEEEKTHLQEKL
RLQHEMELKARLTQAQASFEREREGLQSSAWTEEKVRGLTQELEQFHQEQLTSLVEKHTL
EKEELRKELLEKHQRELQEGRYESEKLQQENSILRNEITTYIFAKTKILLHQLLKPNHIP
FRQKTETVKQENAAVQKMVENLKKQISELKIKNQQLDLENTELSQKNSQNQEKLQELNQR
LTEMLCQKEKEPGNSALEEREQEKFNLKEELERCKVQSSTLVSSLEAELSEFKIQTHIVQ
QENLLLKDELEKMKQLHRCPDLSDFQQKISSVLSYNEKLLKEKEALSEELNSCVDKKQLA
KSSLLEHRIATMKQEQKSWEHQSASLKSELVASQEKVQNLEDTLQNVNLQMSRMKSDLRV
TQQEKEALKQEVMSLHKQLQNAGGKSWAPEIATHPSGLQNQQKRLSWDKLDHLMNEEQQL
LWQENERLQTVVQNTKAELTHSREKVRQLESNLLPKHQKHLNPSGTMKPTEQEKLSLKRE
CDQFQKEQSPANRKVSQMNSLEQELETIHLENEGLKKKQVKLDEQLMEMQHLRSTATPSP
SPHAWDLQLLQQQACPMVPREQFLQLQHQLLQAERINQHLQEELENRTSETNTPQGNQEQ
LVTVMEERMIEVEQKLKLVKSLLQEKVNQLKEQVSLPGHLCSPTSHSSFNSSFTSLYCH
Download sequence
Identical sequences ENSGGOP00000021515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]