SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021537 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021537
Domain Number 1 Region: 259-449
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.15e-54
Family cAMP-binding domain 0.00000000951
Further Details:      
 
Domain Number 2 Region: 2-262
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-35
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021537   Gene: ENSGGOG00000008824   Transcript: ENSGGOT00000024149
Sequence length 651
Comment pep:known_by_projection chromosome:gorGor3.1:15:52884727:52905108:-1 gene:ENSGGOG00000008824 transcript:ENSGGOT00000024149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVED
NTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVETRIDSEVYKTARALRIVRFTKI
LSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPML
QDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVG
ATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGK
MFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYI
IREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLY
SLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSGVFNYQENEII
QQIVQHDREMAHCAHRVQLLPLPPTPTPLIWTPLIQHCRLPPPPLLWPALTHHPRLPAAI
PPSPRIGLGNLGAGQTPTNGFPDPFCAGPASPASSPSQVDTPSSSSDSLPPLDAHSCPHP
SSPPPGACGSPSAPTPSAGAAATTIAGLAPQGAGGSLSSSDSPCSPRPGAR
Download sequence
Identical sequences ENSGGOP00000021537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]