SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021547 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021547
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-26
Family Dual specificity phosphatase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021547   Gene: ENSGGOG00000027871   Transcript: ENSGGOT00000029462
Sequence length 527
Comment pep:novel chromosome:gorGor3.1:9:76064243:76070689:1 gene:ENSGGOG00000027871 transcript:ENSGGOT00000029462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMT
ADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLTPLRNIFSCCDPKAHAVTLAQYLIRQRH
LLHGYEARLLKHVPKIIHLVCKLLLDLAENRPVMMKDVSEGPGLSAEIEKTMSEMVTMQL
DKELLRHDSDVSNPPNPTAVAADFDNRGMIFSNEQQFDPLWKRRNVECLQPLTHLKRRLS
YSDSDLKRAENLLEQGETPQTVPAQIMVGHKPRQQKLISHCYIPQSPEPDLHKEALVRST
LSFWSQSKFGGLEGLKDNGSPIFHGRIIPKEAQQSGAFSADVSGSHSPGEPVSPSFANVH
KDPNPAHQQVSHCQCKTHGVGSPGSVRQNSRIPRSPLDCGSSPKVQFLVEHETQDSKDLS
EAASHSALQSELSAEARRILAAKALANLNESVEKEELKRKVEMWQKELNSRDGAWERICG
ERDPFILCSLMWSWVEQLKEPVITKEDVDMLVNRRADAAEALFLLEK
Download sequence
Identical sequences ENSGGOP00000021547 ENSGGOP00000021547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]