SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021597 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021597
Domain Number 1 Region: 78-221
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-29
Family C-type lectin domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021597   Gene: ENSGGOG00000000505   Transcript: ENSGGOT00000031820
Sequence length 252
Comment pep:known_by_projection chromosome:gorGor3.1:12:10470376:10475068:-1 gene:ENSGGOG00000000505 transcript:ENSGGOT00000031820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYH
CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPFQRHNNSSLNTRTQKARHCGHCPEEW
ITYSNSCYYIGKERRTWEESLLACTSKNSGLLSIDNEEEMKFLSIISPSSWIGVFRNSSH
HPWVTINGLAFKHEIIDSDNAELNCAVLQVNGLKSAQCGSSIIIVSVSFRGKAFAFAVHQ
KFYISNRNIMIA
Download sequence
Identical sequences ENSGGOP00000021597 ENSGGOP00000019344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]