SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021603 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021603
Domain Number 1 Region: 403-513
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-22
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000169
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021603   Gene: ENSGGOG00000006590   Transcript: ENSGGOT00000025005
Sequence length 533
Comment pep:known_by_projection chromosome:gorGor3.1:5:154704471:154758793:-1 gene:ENSGGOG00000006590 transcript:ENSGGOT00000025005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKL
RVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQ
DGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSG
KTPQQPPVPPQRPMAALPPPTAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK
PPLDRSLAPFDREPFTLGKKPPFSDKPFPELHRPLGEHLPKIQKPPLPPTTERHERSSPL
PGKKPPVPKHGWGPDRRENVSTKLHQRPLPQPALLPMSSNTFPSRSTKPSPMNSLPSSHM
PGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES
QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP
Download sequence
Identical sequences ENSGGOP00000021603 ENSGGOP00000006455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]