SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021617 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021617
Domain Number 1 Region: 133-232
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-21
Family PDZ domain 0.025
Further Details:      
 
Domain Number 2 Region: 228-329
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-21
Family PDZ domain 0.047
Further Details:      
 
Domain Number 3 Region: 1014-1125
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-21
Family PDZ domain 0.0000623
Further Details:      
 
Domain Number 4 Region: 640-743
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-20
Family PDZ domain 0.0000348
Further Details:      
 
Domain Number 5 Region: 749-840
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-20
Family PDZ domain 0.0000344
Further Details:      
 
Domain Number 6 Region: 542-640
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-20
Family PDZ domain 0.00000874
Further Details:      
 
Domain Number 7 Region: 334-435
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-20
Family PDZ domain 0.00000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021617   Gene: ENSGGOG00000002279   Transcript: ENSGGOT00000026371
Sequence length 1142
Comment pep:known_by_projection chromosome:gorGor3.1:3:14916241:14970213:-1 gene:ENSGGOG00000002279 transcript:ENSGGOT00000026371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLSSLTEEAVDGGNGGEWGEGLLQQFTCIPSRVVEAKTAPKWPLCPGEGEGLHGEPLPD
HCQGTGGQIDPSLGRGGRTKQRGSRGSWWAAGETIANMLCGLSRETPGEADDGPYSKGGK
DAGGADISLACRRQSIPEEFRGITVVELIKKEGSTLGLTISGGTDKDGKPRVSNLRPGGL
AARSDLLNIGDYIRSVNGIHLTRLRHDEIITLLKNVGERVVLEVEYELPPPAPENNPRII
SKTVDVSLYKEGNSFGFVLRGGAHEDGHKSRPLVLTYVRPGGPADREGSLKVGDRLLSVD
GIPLHGASHATALATLRQCSHEALFQVEYDVATPDTVANASGPLMVEIVKTPGSALGISL
TTTSLRNKSVITIDRIKPASVVDRSGALHPGDHILSIDGTSMEHCSLLEATKLLASVSEK
VRLEILPVPQSQRPLRPSEATVKVQRSEQLHRWDPCVPSCHSPRPGHCRMPTWATPAGQD
QSRSLSSTPFSSPTLNHAFSCNNPSTLPRGSQPMSPRTTMGRRRQRRREHKSSLSLASST
VGPGGQIVHTETTEVVLCGDPLSGFGLQLQGGIFATETLSSPPLVCFIEPDSPAERCGLL
QVGDRVLSINGIATEDGTMEEANQLLRDAALAHKVVLEVEFDVAESVIPSSGTFHVKLPK
KRGVELGITISSASRKRGEPLIISDIKRGSVAHRTGTLEPGDKLLAIDNIRLDNCPMEDA
VQILRQCEDLVKLKIRKDEDNSDELETTGAVSYTVELKRYGGPLGITISGTEEPFDPIVI
SGLTKRGLAERTGAIHVGDRILAINSVSLKGRPLSEAIHLLQVAGETVTLKIKKQLDRPL
LPRKSGSLSETSDADEDPADALKGGLPAARFSPAVPSVDSAVESWDSSATEGGFGGPGSY
TPQAAARGMTPQEWRPGRLRGSPPPTEPRRTSYTPTPADESFPEEEEEEDDWEPPTSPAP
GPAREEGFWRVFGEALEDLESCGQSELLRELEASIMTGTVQRVALEGRPGHRPWQRDREV
RASPAEMEELLLPTPLEMHKVTLHKDPMRHDFGFSVSDGLLEKGVYVHTVRPDGPAHRGG
LRPFDRVLQVNHVRTRDFDCCLAVPLLAEAGDVLELVISRNPHTAHSSRAPRAPGPSSPR
ML
Download sequence
Identical sequences ENSGGOP00000002245 ENSGGOP00000021617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]