SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021620 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021620
Domain Number 1 Region: 33-274
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.3e-67
Family LplA-like 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021620   Gene: ENSGGOG00000026223   Transcript: ENSGGOT00000034458
Sequence length 373
Comment pep:known_by_projection chromosome:gorGor3.1:2a:96547924:96549105:1 gene:ENSGGOG00000026223 transcript:ENSGGOT00000034458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPFSMKNCFQLLCNCQIPAAGFKKTVKNGLILQSVSNDVYQNLAVEDWIHDHMNLEGK
PVLFFWRNSPSVVIGRHQNPWQECNLNLMREEGIKLARRRSGGGTVYHDMGNINLTFFTT
KKKYDRMENLKLIVRALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTL
LCSTDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDPTLTCEVLMNAVATEYAAYHQ
IDNHIHLINPKDETLFPGINSKAKELQTWEWIYGKTPKFSINTSFHVLYEQSHLEIKVFI
DIKNGRIEICNIEAPDHWLPLEIRDKLNSSLIGSKFCPTETTMLTNILLRTCPQDHKLNS
KWNILCEKIKGIM
Download sequence
Identical sequences G3S0M5
XP_004031528.1.27298 ENSGGOP00000021620 ENSGGOP00000021620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]