SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021628 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021628
Domain Number 1 Region: 17-85
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 75-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000821
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 3 Region: 159-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000921
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021628
Domain Number - Region: 133-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0011
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 211-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00305
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021628   Gene: ENSGGOG00000013834   Transcript: ENSGGOT00000026045
Sequence length 377
Comment pep:known_by_projection chromosome:gorGor3.1:2a:109972155:109996902:1 gene:ENSGGOG00000013834 transcript:ENSGGOT00000026045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVVQDEELVILPSLLTVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVVCL
PNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAPEG
SVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLCMH
ACVNTPGSYRCTCPSGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPECP
EGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASA
PGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLDRSF
QANHVSKVTIFVSPYDF
Download sequence
Identical sequences ENSGGOP00000021628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]